Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P01584 |
| Gene Names | IL1B |
| Alternative Names | (IL-1 beta)(Catabolin) |
| Expression Region | 117-269aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.5 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-97℃. |
| Protein Length | Partial |
| Molecular Weight | 21.5 kDa |
| Protein Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Background
| Research Areas | Immunology |
| Relevance | Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells . Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6 . |
| Function | |
| Reference | "Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs."March C.J., Mosley B., Larsen A., Cerretti D.P., Braedt G., Price V., Gillis S., Henney C.S., Kronheim S.R., Grabstein K., Conlon P.J., Hopp T.P., Cosman D.Nature 315:641-647(1985) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
