Recombinant Human Interferon regulatory factor 1(IRF1)

Specification
Organism Homo sapiens (Human)
Expression Host Baculovirus
Tag Info N-terminal 10xHis-tagged and C-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P10914
Gene Names IRF1
Alternative Names Interferon regulatory factor 1; Interferon regulatory factor 1 isoform +I9; Interferon regulatory factor 1 isoform d78; Interferon regulatory factor 1 isoform delta4; Interferon regulatory factor 1 isoform delta7; IRF 1; IRF-1; IRF1; IRF1_HUMAN; MAR; MAR1
Expression Region Full Length(1-325aa )
Molecular Weight 65.5 kDa
Protein Sequence MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity IRF1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$317.00
In stock
SKU
EB-PBUg8118273

Recombinant Human Interferon regulatory factor 1(IRF1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Interferon regulatory factor 1(IRF1)
Copyright © 2021-present Echo Biosystems. All rights reserved.