Recombinant Human Interferon lambda-3(IFNL3) (Active)

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info C-terminal 6xHis-tagged
Purity Greater than 95% as determined by SDS-PAGE.
Uniprot ID Q8IZI9
Uniprot Entry Name
Gene Names IFNL3
Alternative Names Interleukin-28B; IL-28B; Cytokine Zcyto22; Interferon Lambda-3; IFN-Lambda-3; Interferon Lambda-4; IFN-Lambda-4; Interleukin-28C; IL-28C; IL28B; IFNL3; IFNL4; IL28C; ZCYTO22
Expression Region Full Length of Mature Protein (22-196aa)
Molecular Weight 20.67 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance Interleukin-28B, also known as Cytokine Zcyto22, Interferon lambda-3, Interferon lambda-4, IFNL3, IFNL4, ZCYTO22 and IL28B, is a secreted cytokine which belongs to the IL-28/IL-29 family. IL-28 has also been shown to play a role in the adaptive immune response. IL28B has immunomodulatory activity and up-regulates MHC class I antigen expression. IL28B displays potent antiviral activity and antitumor activity. In addition, IL28B is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.
Function Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets
Involvement in disease
Subcellular Location Secreted
Protein Families Lambda interferon family
Tissue Specificity
Pathway Jak-STATsignalingpathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$261.00
In stock
SKU
EB-CAPHU4596

Recombinant Human Interferon lambda-3(IFNL3) (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Interferon lambda-3(IFNL3) (Active)
Copyright © 2026-present Echo Bio. All rights reserved.