Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P32456 |
| Gene Names | GBP2 |
| Alternative Names | (GTP-binding protein 2)(GBP-2)(HuGBP-2)(Guanine nucleotide-binding protein 2)(Interferon-induced guanylate-binding protein 2) |
| Expression Region | 100-259aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.39 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-131℃. |
| Protein Length | Partial |
| Molecular Weight | 22.4 kDa |
| Protein Sequence | GLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEELNPD |
Background
| Research Areas | Immunology |
| Relevance | Hydrolyzes GTP to GMP in 2 consecutive cleavage reactions, but the major reaction product is GDP . Exhibits antiviral activity against influenza virus. Promotes oxidative killing and delivers antimicrobial peptides to autophagolysosomes, providing broad host protection against different pathogen classes. |
| Function | |
| Reference | "GTPase properties of the interferon-induced human guanylate-binding protein 2." Neun R., Richter M.F., Staeheli P., Schwemmle M. FEBS Lett. 390:69-72(1996) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |