Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q14624 |
| Gene Names | ITIH4 |
| Alternative Names | Inter-alpha-trypsin inhibitor family heavy chain-related protein |
| Expression Region | Partial(689-930aa ) |
| Molecular Weight | 42.9 kDa |
| Protein Sequence | RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | ITIH family |
| Tissue Specificity | ITIH4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |