Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P06756 |
| Gene Names | ITGAV |
| Alternative Names | Vitronectin receptor subunit alpha; CD51 |
| Expression Region | Partial(891-1048aa ) |
| Molecular Weight | 19.7 kDa |
| Protein Sequence | DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. In case of HIV-1 infection, the interaction with Extracellular domain viral Tat protein ses to enhance angiogenesis in Kaposi's sarcoma lesions. |
| Involvement in Disease | |
| Subcellular Location | Membrane, Single-pass type I membrane protein, Cell junction, focal adhesion |
| Protein Families | Integrin alpha chain family |
| Tissue Specificity | ITGAV |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |