Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P01344 |
| Uniprot Entry Name | |
| Gene Names | IGF2 |
| Alternative Names | Insulin-Like Growth Factor II; IGF-II; Somatomedin-A; IGF2; PP1446 |
| Expression Region | Full Length of Mature Protein (25-91aa) |
| Molecular Weight | 8.91 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm Filtered 5 mM HAC, PH 3.0) |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Insulin-Like Growth Factor II (IGF2) belongs to the insulin family of polypeptide growth factors that is involved in development and growth. Members of this family are structurally homologous to proinsulin, and share higher sequence identity. IGF2 is expressed only from the paternally inherited allele and believed to be secreted by the liver and to circulate in the blood. IGF2 possess growth-promoting activity and can stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. IGF2 is influenced by placental lactogen and may play a role in fetal development. |
| Function | The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation (By similarity). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable). |
| Involvement in disease | Silver-Russell syndrome (SRS); Growth restriction, severe, with distinctive facies (GRDF) |
| Subcellular Location | Secreted |
| Protein Families | Insulin family |
| Tissue Specificity | Expressed in heart, placenta, lung, liver, muscle, kidney, tongue, limb, eye and pancreas. |
| Pathway | MAPKsignalingpathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |