Specification
Organism | Homo sapiens (Human) |
Expression Host | Mammalian cell |
Tag Info | C-terminal hFc-tagged |
Purity | Greater than 95% as determined by SDS-PAGE. |
Uniprot ID | Q6UW32 |
Uniprot Entry Name | |
Gene Names | IGFL1 |
Alternative Names | |
Expression Region | Full Length of Mature Protein (25-110aa) |
Molecular Weight | 38.7 kDa |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Sequence | APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS |
Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4) |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
Relevance | Probable ligand of the IGFLR1 cell membrane receptor. |
Function | |
Involvement in disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | |
Pathway |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |