Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens insulin like 5 (INSL5) (NM_005478). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9Y5Q6 |
| Entry Name | INSL5_HUMAN |
| Gene Names | INSL5 UNQ156/PRO182 |
| Alternative Gene Names | |
| Alternative Protein Names | Insulin-like peptide INSL5 (Insulin-like peptide 5) [Cleaved into: Insulin-like peptide INSL5 B chain; Insulin-like peptide INSL5 A chain] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 135 |
| Molecular Weight(Da) | 15333 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC |
Background
| Function | FUNCTION: May have a role in gut contractility or in thymic development and regulation. Activates RXFP4 with high potency and appears to be the endogenous ligand for this receptor. |
| Pathway | |
| Protein Families | Insulin family |
| Tissue Specificity | Highly expressed in rectum with lower levels in uterus and ascending and descending colon. {ECO:0000269|PubMed:10458910}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |