Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens insulin like 4 (INSL4) (NM_002195). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q14641 |
| Entry Name | INSL4_HUMAN |
| Gene Names | INSL4 |
| Alternative Gene Names | |
| Alternative Protein Names | Early placenta insulin-like peptide (EPIL) (Insulin-like peptide 4) (Placentin) [Cleaved into: Early placenta insulin-like peptide B chain; Early placenta insulin-like peptide A chain] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 139 |
| Molecular Weight(Da) | 15445 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MASLFRSYLPAIWLLLSQLLRESLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT |
Background
| Function | FUNCTION: May play an important role in trophoblast development and in the regulation of bone formation. |
| Pathway | |
| Protein Families | Insulin family |
| Tissue Specificity | Expressed in placenta, uterus and in fetal perichondrium. Expression levels were increased in both early placentas and molar pregnancies and were reduced in choriocarcinoma cells. {ECO:0000269|PubMed:12414911, ECO:0000269|PubMed:9740319}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |