Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q01973 |
| Gene Names | ROR1 |
| Alternative Names | Neurotrophic tyrosine kinase, receptor-related 1 |
| Expression Region | Partial(30-391aa ) |
| Molecular Weight | 42.6 kDa |
| Protein Sequence | QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Tyrosine-protein kinase receptor whose role is not yet clear. |
| Involvement in Disease | Deafness, autosomal recessive, 108 (DFNB108) |
| Subcellular Location | Membrane, Single-pass type I membrane protein, Cell projection, axon |
| Protein Families | Protein kinase superfamily, Tyr protein kinase family, ROR subfamily |
| Tissue Specificity | ROR1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |