Recombinant Human Immunoglobulin-like domain-containing receptor 2(ILDR2),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q71H61
Gene Names ILDR2
Alternative Names ILDR2; C1orf32Immunoglobulin-like domain-containing receptor 2
Expression Region Extracellular Domain(1-186aa )
Molecular Weight 48.1 kDa
Protein Sequence MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May be involved in lipid homeostasis and ER stress pathways.
Involvement in Disease
Subcellular Location Endoplasmic reticulum membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily, LISCH7 family
Tissue Specificity ILDR2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE1HU751376

Recombinant Human Immunoglobulin-like domain-containing receptor 2(ILDR2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Immunoglobulin-like domain-containing receptor 2(ILDR2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.