Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | Tag-Free |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P01857 |
| Uniprot Entry Name | |
| Gene Names | IGHG1 |
| Alternative Names | g gamma-1 chain C region;IGHG1 |
| Expression Region | Partial (104-330aa) |
| Molecular Weight | 25.9 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | As a monomeric immunoglobulin that is predominately involved in the secondary antibody response and the only isotype that can pass through the human placenta, Immunoglobulin G (IgG) is synthesized and secreted by plasma B cells, and constitutes 75% of serum immunoglobulins in humans. IgG antibodies protect the body against the pathogens by agglutination and immobilization, complement activation, toxin neutralization, as well as the antibody-dependent cell-mediated cytotoxicity (ADCC). IgG tetramer contains two heavy chains (50 kDa ) and two light chains (25 kDa) linked by disulfide bonds, that is the two identical halves form the Y-like shape. IgG is digested by pepsin proteolysis into Fab fragment (antigen-binding fragment) and Fc fragment ("crystallizable" fragment). IgG1 is most abundant in serum among the four IgG subclasses (IgG1, 2, 3 and 4) and binds to Fc receptors (FcγR ) on phagocytic cells with high affinity. |
| Function | Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens |
| Involvement in disease | Multiple myeloma (MM) |
| Subcellular Location | Secreted, Cell membrane |
| Protein Families | |
| Tissue Specificity | |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |