Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | A1A4Y4 |
| Gene Names | IRGM |
| Alternative Names | Immunity-related GTPase family M protein 1 Interferon-inducible protein 1 LPS-stimulated RAW 264.7 macrophage protein 47 homolog |
| Expression Region | Full Length(1-181aa ) |
| Molecular Weight | 47.1 kDa |
| Protein Sequence | MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility |
| Involvement in Disease | Inflammatory bowel disease 19 (IBD19) |
| Subcellular Location | Golgi apparatus membrane, Cell membrane, Cytoplasmic vesicle, phagosome membrane, Cytoplasmic vesicle, autophagosome membrane, Cell projection, phagocytic cup |
| Protein Families | TRAFAC class dynamin-like GTPase superfamily, IRG family |
| Tissue Specificity | IRGM |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |