Recombinant Human IL31 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens interleukin 31 (IL31) (NM_001014336).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q6EBC2
Entry Name IL31_HUMAN
Gene Names IL31
Alternative Gene Names
Alternative Protein Names Interleukin-31 (IL-31)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 164
Molecular Weight(Da) 18205
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEKGVLVSQNYTLPCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT
Background
Function FUNCTION: Activates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR (PubMed:15184896). May function in skin immunity (PubMed:15184896). Enhances myeloid progenitor cell survival in vitro (By similarity). Induces RETNLA and serum amyloid A protein expression in macrophages (By similarity). {ECO:0000250|UniProtKB:Q6EAL8, ECO:0000269|PubMed:15184896}.
Pathway
Protein Families
Tissue Specificity Detected at low levels in testis, bone marrow, skeletal muscle, kidney, colon, thymus, small intestine and trachea. {ECO:0000269|PubMed:15184896}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8530505

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human IL31 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.