Recombinant Human IL1F10 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens interleukin 1 family member 10 (IL1F10), transcript variant 1 (NM_032556).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8WWZ1
Entry Name IL1FA_HUMAN
Gene Names IL1F10 FIL1T IL1HY2 IL38 FKSG75 UNQ6119/PRO20041
Alternative Gene Names FIL1T IL1HY2 IL38
Alternative Protein Names Interleukin-1 family member 10 (IL-1F10) (Family of interleukin 1-theta) (FIL1 theta) (Interleukin-1 HY2) (IL-1HY2) (Interleukin-1 theta) (IL-1 theta) (Interleukin-38) (IL-38)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 152
Molecular Weight(Da) 16943
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW
Background
Function FUNCTION: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2. {ECO:0000269|PubMed:22315422}.
Pathway
Protein Families IL-1 family
Tissue Specificity Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8368287

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human IL1F10 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.