Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens interferon induced transmembrane protein 5 (IFITM5) (NM_001025295). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | A6NNB3 |
| Entry Name | IFM5_HUMAN |
| Gene Names | IFITM5 |
| Alternative Gene Names | |
| Alternative Protein Names | Interferon-induced transmembrane protein 5 (Bone-restricted interferon-induced transmembrane protein-like protein) (BRIL) (Dispanin subfamily A member 1) (DSPA1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 132 |
| Molecular Weight(Da) | 14378 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD |
Background
| Function | FUNCTION: Required for normal bone mineralization. {ECO:0000269|PubMed:24519609}. |
| Pathway | |
| Protein Families | CD225/Dispanin family |
| Tissue Specificity | Detected in bone (PubMed:24058703). Detected in osteoblasts and fibroblasts (at protein level) (PubMed:24519609). Detected in bone (PubMed:24058703). Detected in osteoblasts and fibroblasts (PubMed:24519609). {ECO:0000269|PubMed:24058703, ECO:0000269|PubMed:24519609}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |