Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens inhibitor of DNA binding 3, HLH protein (ID3) (NM_002167). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q02535 |
| Entry Name | ID3_HUMAN |
| Gene Names | ID3 1R21 BHLHB25 HEIR1 |
| Alternative Gene Names | 1R21 BHLHB25 HEIR1 |
| Alternative Protein Names | DNA-binding protein inhibitor ID-3 (Class B basic helix-loop-helix protein 25) (bHLHb25) (Helix-loop-helix protein HEIR-1) (ID-like protein inhibitor HLH 1R21) (Inhibitor of DNA binding 3) (Inhibitor of differentiation 3) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 119 |
| Molecular Weight(Da) | 12999 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH |
Background
| Function | FUNCTION: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Involved in myogenesis by inhibiting skeletal muscle and cardiac myocyte differentiation and promoting muscle precursor cells proliferation. Inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. {ECO:0000269|PubMed:8437843}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |