Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase(HPRT1)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P00492
Gene Names HPRT1
Alternative Names /
Expression Region Full Length of Mature Protein(2-218aa )
Molecular Weight 28.4 kDa
Protein Sequence ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.
Involvement in Disease Lesch-Nyhan syndrome (LNS); Gout HPRT-related (GOUT-HPRT)
Subcellular Location Cytoplasm
Protein Families Purine/pyrimidine phosphoribosyltransferase family
Tissue Specificity HPRT1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE6HU10831

Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase(HPRT1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase(HPRT1)
Copyright © 2021-present Echo Biosystems. All rights reserved.