Recombinant Human HSPB2 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens heat shock protein family B (small) member 2 (HSPB2) (NM_001541).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q16082
Entry Name HSPB2_HUMAN
Gene Names HSPB2
Alternative Gene Names
Alternative Protein Names Heat shock protein beta-2 (HspB2) (DMPK-binding protein) (MKBP)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 182
Molecular Weight(Da) 20233
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
Background
Function FUNCTION: May regulate the kinase DMPK. {ECO:0000269|PubMed:9490724}.
Pathway
Protein Families Small heat shock protein (HSP20) family
Tissue Specificity Expressed preferentially in skeletal muscle and heart but not in the lens.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8251505

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human HSPB2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.