Recombinant Human Homeobox protein TGIF2LX(TGIF2LX)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q8IUE1
Gene Names TGIF2LX
Alternative Names TGF-beta-induced transcription factor 2-like protein;TGFB-induced factor 2-like protein, X-linkedTGIF-like on the X
Expression Region Full Length(1-241aa )
Molecular Weight 42.7 kDa
Protein Sequence MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May have a transcription role in testis.
Involvement in Disease
Subcellular Location Nucleus
Protein Families TALE/TGIF homeobox family
Tissue Specificity TGIF2LX
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE4HU808659

Recombinant Human Homeobox protein TGIF2LX(TGIF2LX)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Homeobox protein TGIF2LX(TGIF2LX)
Copyright © 2021-present Echo Biosystems. All rights reserved.