Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P01920 |
| Gene Names | HLA-DQB1 |
| Alternative Names | CELIAC1; DQ beta 1 chain; DQB1_HUMAN; HLA class II histocompatibility antigen; HLA class II histocompatibility antigen; DQ beta 1 chain; HLA class II histocompatibility antigen; DQ beta 2 chain; HLA DQB; HLA DQB1; HLA-DQB1; HLA-DQB2; IDDM1; Lymphocyte antigen; Major histocompatibility complex class II beta; Major histocompatibility complex; class II; DQ beta 1; MHC class II antigen DQB1; MHC class II antigen HLA DQ beta 1; MHC class II DQ beta chain; MHC class II HLA DQ beta glycoprotein; MHC class2 antigen; MHC DQ beta; OTTHUMP00000029167; OTTHUMP00000178569; OTTHUMP00000178570; OTTHUMP00000178571 |
| Expression Region | Partial(33-227aa ) |
| Molecular Weight | 27 kDa |
| Protein Sequence | RDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus, trans-Golgi network membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein |
| Protein Families | MHC class II family |
| Tissue Specificity | HLA-DQB1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |