Recombinant Human Histone H3.1 (H3C1)

Specification
Gene Names H3C1
Alternative Names Histone H3/a;Histone H3/b;Histone H3/c;Histone H3/d;Histone H3/f;Histone H3/h;Histone H3/i;Histone H3/j;Histone H3/k;Histone H3/l
Organism Homo sapiens (Human)
Expression Host E.coli
Molecular Weight 21.3 kDa
Expression Region Full Length of Mature Protein(2-136aa )
Expression Region N-terminal 10xHis-tagged(Full Length of Mature Protein )
Purity Greater than 85% as determined by SDS-PAGE.
Endotoxin
Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Protein Sequence ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Background
Research Areas Epigenetics and Nuclear Signaling
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$246.00
In stock
SKU
EB-E2b03125460

Recombinant Human Histone H3.1 (H3C1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Histone H3.1 (H3C1)
Copyright © 2026-present Echo Bio. All rights reserved.