Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P09429 |
| Gene Names | HMGB1 |
| Alternative Names | High mobility group protein 1 ;HMG-1 |
| Expression Region | Partial(8-179aa ) |
| Molecular Weight | 46.7 kDa |
| Protein Sequence | KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type Cytoplasmic domain processes in developing cells . |
| Involvement in Disease | |
| Subcellular Location | Nucleus, Chromosome, Cytoplasm, Secreted, Cell membrane, Peripheral membrane protein, Extracellular side, Endosome, Endoplasmic reticulum-Golgi intermediate compartment |
| Protein Families | HMGB family |
| Tissue Specificity | HMGB1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
