Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | O00479 |
Gene Names | HMGN4 |
Alternative Names | HMGN4; HMG17L3; NHC; High mobility group nucleosome-binding domain-containing protein 4; Non-histone chromosomal protein HMG-17-like 3; Non-histone chromosomal protein |
Expression Region | Full Length(1-90aa ) |
Molecular Weight | 36.5 kDa |
Protein Sequence | MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Non-histone chromosomal protein HMG-17-like 3 |
Involvement in Disease | |
Subcellular Location | Nucleus |
Protein Families | HMGN family |
Tissue Specificity | HMGN4 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |