Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma(FCER1G),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-B2M-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P30273
Gene Names FCER1G
Alternative Names Fc receptor gamma-chain ;FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma ;FceRI gamma
Expression Region Cytoplasmic Domain(45-86aa )
Molecular Weight 18.9 kDa
Protein Sequence RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
Involvement in Disease
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families CD3Z/FCER1G family
Tissue Specificity FCER1G
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PEHU185456

Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma(FCER1G),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma(FCER1G),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.