Specification
    
        | Organism | Homo sapiens (Human) | 
| Expression Host | E.coli | 
| Tag Info | N-terminal GST-tagged | 
| Purity | Greater than 85% by SDS-PAGE | 
| Uniprot ID | P30273 | 
| Gene Names | FCER1G | 
| Alternative Names | Fc receptor gamma-chain ;FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma ;FceRI gamma | 
| Expression Region | Full Length of Mature Protein(19-86aa ) | 
| Molecular Weight | 34.8 kDa | 
| Protein Sequence | LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ | 
| Form | Liquid or Lyophilization | 
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. | 
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. | 
        Background
    
        | Relevance | Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin. | 
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein | 
| Protein Families | CD3Z/FCER1G family | 
| Tissue Specificity | FCER1G | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) |  | 
 
