Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P19367 |
Gene Names | HK1 |
Alternative Names | Brain form hexokinaseHexokinase type I ;HK I |
Expression Region | Partial(476-917aa ) |
Molecular Weight | 65.3 kDa |
Protein Sequence | HFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | |
Involvement in Disease | Hexokinase deficiency (HK deficiency); Neuropathy, hereditary motor and sensory, Russe type (HMSNR); Retinitis pigmentosa 79 (RP79) |
Subcellular Location | Mitochondrion outer membrane |
Protein Families | Hexokinase family |
Tissue Specificity | HK1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |