Recombinant Human Heterogeneous nuclear ribonucleoprotein H(HNRNPH1),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P31943
Gene Names HNRNPH1
Alternative Names DKFZp686A15170; Heterogeneous nuclear ribonucleoprotein H; Heterogeneous nuclear ribonucleoprotein H1 (H); Heterogeneous nuclear ribonucleoprotein H1; HNRH1_HUMAN; hnRNP H; hnRNPH; Hnrnph1; HNRPH 1; HNRPH; HNRPH1 protein; N-terminally processed
Expression Region Partial(2-216aa )
Molecular Weight 51.2 kDa
Protein Sequence MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG).
Involvement in Disease
Subcellular Location Nucleus, nucleoplasm
Protein Families
Tissue Specificity HNRNPH1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PEHU2106217

Recombinant Human Heterogeneous nuclear ribonucleoprotein H(HNRNPH1),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Heterogeneous nuclear ribonucleoprotein H(HNRNPH1),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.