Recombinant Human HES3 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens hes family bHLH transcription factor 3 (HES3) (NM_001024598).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q5TGS1
Entry Name HES3_HUMAN
Gene Names HES3 BHLHB43
Alternative Gene Names BHLHB43
Alternative Protein Names Transcription factor HES-3 (Class B basic helix-loop-helix protein 43) (bHLHb43) (Hairy and enhancer of split 3)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 186
Molecular Weight(Da) 19968
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVPRGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPCTPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGSPGDDLN
Background
Function FUNCTION: Transcriptional repressor of genes that require a bHLH protein for their transcription. {ECO:0000250}.
Pathway
Protein Families
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8171105

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human HES3 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.