Recombinant Human herpesvirus 6B Protein U24(U24)

Specification
Organism Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9QJ42
Gene Names U24
Alternative Names U24 protein
Expression Region Full Length(1-88aa )
Molecular Weight 16.2 kDa
Protein Sequence MDRPRTPPPSYSEVLMMDVMYGQVSPHASNDTSFVECLPPPQSSRSAWNLWNKRRKTFAFLVLTGLAIAMILFIAFVIYVFNVNRRKK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Down-regulates the TCR/CD3E complex and the transferrin receptor TFRC in host T-cells by blocking them from recycling back to the cell surface.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity U24
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$1,536.00
In stock
SKU
EB-PCHKA865679

Recombinant Human herpesvirus 6B Protein U24(U24)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human herpesvirus 6B Protein U24(U24)
Copyright © 2026-present Echo Bio. All rights reserved.