Specification
| Organism | Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus) |
| Expression Host | in vitro E.coli expression system |
| Tag Info | N-terminal 10xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9QJ42 |
| Gene Names | U24 |
| Alternative Names | U24 protein |
| Expression Region | Full Length(1-88aa ) |
| Molecular Weight | 16.2 kDa |
| Protein Sequence | MDRPRTPPPSYSEVLMMDVMYGQVSPHASNDTSFVECLPPPQSSRSAWNLWNKRRKTFAFLVLTGLAIAMILFIAFVIYVFNVNRRKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Down-regulates the TCR/CD3E complex and the transferrin receptor TFRC in host T-cells by blocking them from recycling back to the cell surface. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | U24 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |