Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog(KA3L),partial

Specification
Organism Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P52539
Gene Names KA3L
Alternative Names /
Expression Region Partial(135-364aa )
Molecular Weight 34.6 kDa
Protein Sequence CLLTNDILETDLLLRYRQCLDSLTREENQQLMGDRIFSLTNSPCLAFTVATVEEACSYFKFHDLHNLPVNPQDLFMYTITVMKFEFFNKLNMAKLTCVFNDNGHGDIEYRKLRQLCGKPVLDREMPNSEFEVQQQTPDSFRHPIQQAMSIVVTFARILRQIKEHIIRTKKPQFIRDFDTERVAERYECGLISRLIGKQFSNHKCDDVSCQNRIERIMAPWKPSLFFCTYF
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Immediate early (EI) protein that plays many roles during productive infection including regulation of viral gene expression and nuclear export of intronless viral RNAs.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity KA3L
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEHKA345735

Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog(KA3L),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog(KA3L),partial
Copyright © 2026-present Echo Bio. All rights reserved.