Recombinant Human herpesvirus 6A Probable ganciclovir kinase(U69),partial

Specification
Organism Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P24446
Gene Names U69
Alternative Names /
Expression Region Partial(170-355aa )
Molecular Weight 25.1 kDa
Protein Sequence SEERSYSVVYVPHNKELCGQFCQPEKTMARVLGVGAYGKVFDLDKVAIKTANEDESVISAFIAGVIRAKSGADLLSHECVINNLLISNSVCMSHKVSLSRTYDIDLHKFEDWDVRNVMNYYSVFCKLADAVRFLNLKCRINHFDISPMNIFLNHKKEIIFDAVLADYSLSEMHPNYNGTCAIAKEY
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Phosphorylates the antiviral nucleoside analog ganciclovir.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity U69
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEHJZ329599

Recombinant Human herpesvirus 6A Probable ganciclovir kinase(U69),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human herpesvirus 6A Probable ganciclovir kinase(U69),partial
Copyright © 2026-present Echo Bio. All rights reserved.