Recombinant Human herpesvirus 6A G-protein coupled receptor homolog U51(U51),partial

Specification
Organism Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)
Expression Host E.coli
Protein Tag N-terminal 6xHis-KSI-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Level Not test.
Biological Activity
Uniprot ID P52382
Gene Names U51
Alternative Names
Expression Region 260-301aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.456 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-570℃.
Protein Length Partial
Molecular Weight 20.2 kDa
Protein Sequence CDDHTVPVRLCSIWLVNLCKKCFSCTRREKESDLEVGIKMLK
Background
Research Areas Others
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$378.00
In stock
SKU
EB-N231491

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human herpesvirus 6A G-protein coupled receptor homolog U51(U51),partial
Copyright © 2026-present Echo Bio. All rights reserved.