Recombinant Human herpesvirus 1 Envelope glycoprotein G(gG)

Specification
Organism Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P06484
Gene Names gG
Alternative Names gG-1
Expression Region Full Length of Mature Protein(25-238aa )
Molecular Weight 28.8 kDa
Protein Sequence VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALDTLFVVSTVIHTLSFLCIGAMATHLCGGWSRRGRRTHPSVRYVCLPSERG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Chemokine-binding protein that inhibits neutrophils' chemotaxis.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity gG
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$1,716.00
In stock
SKU
EB-PCHWY361969

Recombinant Human herpesvirus 1 Envelope glycoprotein G(gG)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human herpesvirus 1 Envelope glycoprotein G(gG)
Copyright © 2026-present Echo Bio. All rights reserved.