Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9Y5N5 |
| Gene Names | N6AMT1 |
| Alternative Names | M.HsaHemK2P N(6)-adenine-specific DNA methyltransferase 1 |
| Expression Region | Full Length of Isoform 2(1-186aa ) |
| Molecular Weight | 46.8 kDa |
| Protein Sequence | MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Eukaryotic/archaeal PrmC-related family |
| Tissue Specificity | N6AMT1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |