Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q9Y5N5 |
Gene Names | N6AMT1 |
Alternative Names | M.HsaHemK2P N(6)-adenine-specific DNA methyltransferase 1 |
Expression Region | Full Length of Isoform 2(1-186aa ) |
Molecular Weight | 46.8 kDa |
Protein Sequence | MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | Eukaryotic/archaeal PrmC-related family |
Tissue Specificity | N6AMT1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |