Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens host cell factor C1 regulator 1 (HCFC1R1), transcript variant 1 (NM_017885). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9NWW0 |
| Entry Name | HPIP_HUMAN |
| Gene Names | HCFC1R1 HPIP |
| Alternative Gene Names | HPIP |
| Alternative Protein Names | Host cell factor C1 regulator 1 (HCF-1 beta-propeller-interacting protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 138 |
| Molecular Weight(Da) | 15291 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MILQQPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPMTFSPALPPLRSPCSELLLWRYPGSLIPEALRLLRLGDTPSPPYPATPAGDIMEL |
Background
| Function | FUNCTION: Regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus. {ECO:0000269|PubMed:12235138}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Widely expressed. {ECO:0000269|PubMed:12235138}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |