Recombinant Human HARBI1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens harbinger transposase derived 1 (HARBI1) (NM_173811).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96MB7
Entry Name HARB1_HUMAN
Gene Names HARBI1 C11orf77
Alternative Gene Names C11orf77
Alternative Protein Names Putative nuclease HARBI1 (EC 3.1.-.-) (Harbinger transposase-derived nuclease)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 349
Molecular Weight(Da) 39146
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS
Background
Function FUNCTION: Transposase-derived protein that may have nuclease activity (Potential). Does not have transposase activity. {ECO:0000269|PubMed:15169610, ECO:0000269|PubMed:18339812, ECO:0000305}.
Pathway
Protein Families HARBI1 family
Tissue Specificity Detected in brain, eye, nerve tissue, kidney and lung. {ECO:0000269|PubMed:15169610}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8150245

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human HARBI1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.