Recombinant Human GZMA protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens granzyme A (GZMA) (NM_006144).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P12544
Entry Name GRAA_HUMAN
Gene Names GZMA CTLA3 HFSP
Alternative Gene Names CTLA3 HFSP
Alternative Protein Names Granzyme A (EC 3.4.21.78) (CTL tryptase) (Cytotoxic T-lymphocyte proteinase 1) (Fragmentin-1) (Granzyme-1) (Hanukkah factor) (H factor) (HF)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 262
Molecular Weight(Da) 28999
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
Background
Function FUNCTION: Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse (PubMed:3257574, PubMed:3262682, PubMed:3263427, PubMed:32299851, PubMed:12819770). It cleaves after Lys or Arg (PubMed:32299851, PubMed:12819770). Once delivered into the target cell, acts by catalyzing cleavage of gasdermin-B (GSDMB), releasing the pore-forming moiety of GSDMB, thereby triggering pyroptosis and target cell death (PubMed:32299851). Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity (PubMed:12524539). Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA (PubMed:11555662, PubMed:12628186, PubMed:16818237). {ECO:0000269|PubMed:11555662, ECO:0000269|PubMed:12524539, ECO:0000269|PubMed:12628186, ECO:0000269|PubMed:12819770, ECO:0000269|PubMed:16818237, ECO:0000269|PubMed:32299851, ECO:0000269|PubMed:3257574, ECO:0000269|PubMed:3262682, ECO:0000269|PubMed:3263427}.
Pathway
Protein Families Peptidase S1 family, Granzyme subfamily
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8147715

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human GZMA protein
Copyright © 2021-present Echo Biosystems. All rights reserved.