Recombinant Human GYG1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens glycogenin 1 (GYG1), transcript variant 3 (NM_001184721).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P46976
Entry Name GLYG_HUMAN
Gene Names GYG1 GYG
Alternative Gene Names GYG
Alternative Protein Names Glycogenin-1 (GN-1) (GN1) (EC 2.4.1.186)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 350
Molecular Weight(Da) 39384
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ
Background
Function FUNCTION: Self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substrate for glycogen synthase. {ECO:0000269|PubMed:22160680, ECO:0000269|PubMed:30356213}.
Pathway Glycan biosynthesis; glycogen biosynthesis.
Protein Families Glycosyltransferase 8 family, Glycogenin subfamily
Tissue Specificity Highly expressed in skeletal muscle and heart, with lower levels in brain, lung, kidney and pancreas. {ECO:0000269|PubMed:8602861}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8498158

Recombinant Human GYG1 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human GYG1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.