Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens guanylate cyclase activator 2A (GUCA2A) (NM_033553). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q02747 |
| Entry Name | GUC2A_HUMAN |
| Gene Names | GUCA2A GUCA2 |
| Alternative Gene Names | GUCA2 |
| Alternative Protein Names | Guanylin (Guanylate cyclase activator 2A) (Guanylate cyclase-activating protein 1) (Guanylate cyclase-activating protein I) (GCAP-I) [Cleaved into: HMW-guanylin; Guanylin] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 115 |
| Molecular Weight(Da) | 12388 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC |
Background
| Function | FUNCTION: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. |
| Pathway | |
| Protein Families | Guanylin family |
| Tissue Specificity | Highly expressed in ileum and colon. Found in plasma. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |