Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P62879 |
| Gene Names | GNB2 |
| Alternative Names | G protein subunit beta-2Transducin beta chain 2 |
| Expression Region | Partial(21-327aa ) |
| Molecular Weight | 60.4 kDa |
| Protein Sequence | ARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmbrane signaling systs. The beta and gamma chains are required for the GTPase activity, for replacent of GDP by GTP, and for G protein-effector interaction. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, perinuclear region |
| Protein Families | WD repeat G protein beta family |
| Tissue Specificity | GNB2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |