Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens general transcription factor IIA subunit 2 (GTF2A2), transcript variant 1 (NM_004492). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P52657 |
| Entry Name | T2AG_HUMAN |
| Gene Names | GTF2A2 TF2A2 |
| Alternative Gene Names | TF2A2 |
| Alternative Protein Names | Transcription initiation factor IIA subunit 2 (General transcription factor IIA subunit 2) (TFIIA p12 subunit) (TFIIA-12) (TFIIAS) (Transcription initiation factor IIA gamma chain) (TFIIA-gamma) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 109 |
| Molecular Weight(Da) | 12457 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE |
Background
| Function | FUNCTION: TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity. {ECO:0000269|PubMed:11030333}. |
| Pathway | |
| Protein Families | TFIIA subunit 2 family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |