Specification
    
        | Description | Recombinant protein from the full-length sequence of Homo sapiens general transcription factor IIA subunit 2 (GTF2A2), transcript variant 1 (NM_004492). | 
| Organism | Homo sapiens (Human) | 
| Expression Host | Human Cells | 
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. | 
| Purity | Greater than 90% by SDS-PAGE gel | 
| Uniprot ID | P52657 | 
| Entry Name | T2AG_HUMAN | 
| Gene Names | GTF2A2 TF2A2 | 
| Alternative Gene Names | TF2A2 | 
| Alternative Protein Names | Transcription initiation factor IIA subunit 2 (General transcription factor IIA subunit 2) (TFIIA p12 subunit) (TFIIA-12) (TFIIAS) (Transcription initiation factor IIA gamma chain) (TFIIA-gamma) | 
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! | 
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives | 
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) | 
| Length | 109 | 
| Molecular Weight(Da) | 12457 | 
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE | 
        Background
    
        | Function | FUNCTION: TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity. {ECO:0000269|PubMed:11030333}. | 
| Pathway | |
| Protein Families | TFIIA subunit 2 family | 
| Tissue Specificity | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) |  | 
 
