Recombinant Human Growth-regulated alpha protein(CXCL1)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P09341
Gene Names CXCL1
Alternative Names C-X-C motif chemokine 1;GRO-alpha(1-73)Melanoma growth stimulatory activity ;MGSANeutrophil-activating protein 3 ;NAP-3
Expression Region Full Length of Mature Protein(35-107aa )
Molecular Weight 11.9 kDa
Protein Sequence ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Has chotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chotactic activity.
Involvement in Disease
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Tissue Specificity CXCL1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE9HU6364

Recombinant Human Growth-regulated alpha protein(CXCL1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Growth-regulated alpha protein(CXCL1)
Copyright © 2021-present Echo Biosystems. All rights reserved.