Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q99988 |
| Gene Names | GDF15 |
| Alternative Names | Macrophage inhibitory cytokine 1 ;MIC-1NSAID-activated gene 1 protein ;NAG-1NSAID-regulated gene 1 protein ;NRG-1;Placental TGF-betaPlacental bone morphogenetic protein;Prostate differentiation factor |
| Expression Region | Partial(198-308aa ) |
| Molecular Weight | 16.2 kDa |
| Protein Sequence | RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | Plasma levels are increased in children with concomitant heart disease and failure to thrive but not in children with heart disease and normal body weight. |
| Subcellular Location | Secreted |
| Protein Families | TGF-beta family |
| Tissue Specificity | GDF15 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |