Recombinant Human Group XIIA secretory phospholipase A2(PLA2G12A)

Specification
Organism Homo sapiens (Human)
Expression Host Baculovirus
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9BZM1
Gene Names PLA2G12A
Alternative Names Phosphatidylcholine 2-acylhydrolase 12A (GXII sPLA2) (sPLA2-XII) (PLA2G12)
Expression Region Full Length of Mature Protein(23-189aa )
Molecular Weight 22.6 kDa
Protein Sequence QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity PLA2G12A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$425.00
In stock
SKU
EB-PBA48636509

Recombinant Human Group XIIA secretory phospholipase A2(PLA2G12A)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Group XIIA secretory phospholipase A2(PLA2G12A)
Copyright © 2021-present Echo Biosystems. All rights reserved.