Recombinant Human GPSM3 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens G protein signaling modulator 3 (GPSM3), transcript variant 2 (NM_022107).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9Y4H4
Entry Name GPSM3_HUMAN
Gene Names GPSM3 AGS4 C6orf9 G18
Alternative Gene Names AGS4 C6orf9 G18
Alternative Protein Names G-protein-signaling modulator 3 (Activator of G-protein signaling 4) (G18.1b) (Protein G18)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 160
Molecular Weight(Da) 17866
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC
Background
Function FUNCTION: Interacts with subunit of G(i) alpha proteins and regulates the activation of G(i) alpha proteins. {ECO:0000269|PubMed:14656218, ECO:0000269|PubMed:15096500}.
Pathway
Protein Families
Tissue Specificity Expressed in heart, placenta, lung and liver. {ECO:0000269|PubMed:15096500}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8052395

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human GPSM3 protein
Copyright © 2026-present Echo Bio. All rights reserved.