Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O14653 |
| Gene Names | GOSR2 |
| Alternative Names | 27KDA Golgi SNARE protein;Membrin |
| Expression Region | Cytoplasmic Domain(1-190aa ) |
| Molecular Weight | 38.3 kDa |
| Protein Sequence | MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network. |
| Involvement in Disease | Epilepsy, progressive myoclonic 6 (EPM6) |
| Subcellular Location | Golgi apparatus, cis-Golgi network membrane, Single-pass type IV membrane protein, Golgi apparatus membrane, Endoplasmic reticulum membrane |
| Protein Families | GOSR2 family |
| Tissue Specificity | GOSR2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |