Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens golgin A7 (GOLGA7), transcript variant 3 (NM_001174124). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q7Z5G4 |
| Entry Name | GOGA7_HUMAN |
| Gene Names | GOLGA7 GCP16 HDCKB03P HSPC041 |
| Alternative Gene Names | GCP16 |
| Alternative Protein Names | Golgin subfamily A member 7 (Golgi complex-associated protein of 16 kDa) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 137 |
| Molecular Weight(Da) | 15824 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR |
Background
| Function | FUNCTION: May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. {ECO:0000269|PubMed:14522980, ECO:0000269|PubMed:16000296}. |
| Pathway | |
| Protein Families | ERF4 family |
| Tissue Specificity | Expressed in all tissues except colon and thymus. {ECO:0000269|PubMed:14522980, ECO:0000269|PubMed:16000296}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |