Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens G protein subunit gamma 4 (GNG4), transcript variant 3 (NM_004485). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P50150 |
| Entry Name | GBG4_HUMAN |
| Gene Names | GNG4 GNGT4 |
| Alternative Gene Names | GNGT4 |
| Alternative Protein Names | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 75 |
| Molecular Weight(Da) | 8389 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL |
Background
| Function | FUNCTION: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. {ECO:0000305}. |
| Pathway | |
| Protein Families | G protein gamma family |
| Tissue Specificity | Brain, kidney, pancreas, skeletal muscle and faintly in cardiac muscle. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |